G6pc3 Rabbit Polyclonal Antibody TA337754 from OriGene Technologies | Biocompare.com

Supplier Images

G6pc3 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
G6pc3 Rabbit Polyclonal Antibody

The G6pc3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to G6PC3. This antibody recognizes Mouse antigen. The G6pc3 Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-G6pc3 Antibody

Product Specs
ItemG6pc3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA337754
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetG6pc3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-G6pc3 antibody is: synthetic peptide directed towards the middle region of Mouse G6pc3. Synthetic peptide located within the following region: PEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIAC
NCBI Full Gene Nameglucose 6 phosphatase, catalytic, 3
NCBI Gene AliasesAU019276, AV128920, AU045429, AW545836, UGRP, 0710001K01Rik
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!